PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI12G04670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 947aa    MW: 103470 Da    PI: 4.7376
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI12G04670.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.6e-1755102148
                      TSSS-HH.HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTte.EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+e Ed+++v+ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  OMERI12G04670.1  55 KGNWTPEeEDDIIVQMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 102
                      799**8725789*********************.*************97 PP

2Myb_DNA-binding47.34.8e-15108150145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE+  l++a++++G++ W+   + ++ gRt++ +k++w+
  OMERI12G04670.1 108 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNAIKNHWN 150
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.99450106IPR017930Myb domain
SuperFamilySSF466897.86E-2853149IPR009057Homeodomain-like
SMARTSM007173.6E-1454104IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-2456110IPR009057Homeodomain-like
CDDcd001679.36E-1457102No hitNo description
PfamPF139212.4E-1558119No hitNo description
SMARTSM007174.4E-14107155IPR001005SANT/Myb domain
PROSITE profilePS5129419.654107157IPR017930Myb domain
CDDcd001676.66E-11110150No hitNo description
Gene3DG3DSA:1.10.10.606.2E-21111157IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 947 aa     Download sequence    Send to blast
MSSVMMTSDN GKAPEKGGEA SGPSSAPQEG EISNEPQRRR PLSGRTTGPT RRSTKGNWTP  60
EEEDDIIVQM VNKLGPKKWS TIAQALPGRI GKQCRERWHN HLNPGINKEA WTQEEEITLI  120
HAHRMYGNKW AELTKFLPGR TDNAIKNHWN SSVKKKVDSY MSSGLLTQVS CLPLNEYSAH  180
CNSSPAVTQQ NSEDSGSYAV REVENSSVCS QSSLAKVSCS QVHNANVALG CDLQVNANVD  240
NNEAHDSQSS VGHEACYTSV GAVATAMPEV HYHVSSSNFD PDQHLQEEFA QGLNLHMSID  300
EVPSNSSFAD NPTICRIENH ERSLEPYDVA MEMPLSMLPS DSGAEQKLHF MSEADFNSPN  360
CLKSELWQDI SLQSLLSGPD AVETDSFSRS NHQSDVYSSQ ADNEFLAPPY LLQTSNSSSV  420
MEATYGQSPQ MSVPPSLFCS NVMTDVPSDN RSEPKEMTVS QAEMVTQSSS SSGDAEMSAN  480
PGSSNGSDIP SMMERIPECA DQQVTNAEEP EASIEKEPSV TPSATADEKQ DEGALFYEPP  540
RFPSMDVPFV SCDLVTSGDL QEYSPLGIRQ LMRSTMNVCT PMRLWGSPTH DESPDILLKS  600
AAKSFICTPS ILKKRHRDLV SPIPDKRIEK KSGTEKDCGV SDTSSIGIQT